Jose's Idea
That's right, this is Jose's idea. Guess this scene off of the audio I will send in the gc.
Yuji and Mahito scene after Nanamis death.
Everyone plays this one
You all have to voice act the "I WILL NOT LET YOU DESTROY MY WORLD" line by Goku the one who I feel is closest gets the points
W category
Jujutsu Kaisen:
WTSTIS
With this sacred treasure I summon
Name an anime I've watched
You prolly got it right
Pocket monsters are peculiar organisms with a broad variety of distinct skills and looks; many individuals, referred to as pocket monster instructors, capture and educate them, frequently with the aim of fighting others. (Insert name) has not only fantasized about becoming a pocket monster instructor but also a "Pocket Monster Master," and upon the coming of his 10th birthday, he ultimately has an opportunity to make that fantasy a reality. Unfortunately for him, all three pocket monsters accessible to novice instructors have already been taken and only (Insert name), a defiant Electric pocket monster, stays. However, this accidental meeting would mark the beginning of a lifelong friendship and an epic journey!
Starting on a trip to become the top, (name) and (name) traverse lovely, vast territories with their buddies (name), a Water instructor, and (name), a Rock instructor. But danger is hiding around every corner. The infamous Team Missile is always close by, attempting to take strong pocket monsters through evil plots. It'll be up to (name) and his buddies to stop their attempts as he also tries to get the eight pocket monster gym badges he'll require to confront the pocket monster league, and eventually take the title of Pocket Monster Master.
Pokemon
WELCOME TO THE STUDIO. Me and my brothers really worked hard putting out vocal efforts into it. Hope yall like.
Everyone plays this one
Give me your best "BELIEVE IT" closest gets the points
Datebayo
Attack on Titan
MSDNBORYWFTCOTWMSDPFMSSOMSR
my soldiers do not buckle or yield when faced with the cruelty of this world! My soldiers push forward! My soldiers scream out! My soldiers RAAAAAGE
What show have I re watched the most
JJK I have seen this about 7 times already
Hanging with weird ghost trash in the spooky club, a high schooler chills in the club room or the sick place, dropping by to visit his old grandpa. But this chill life gets flipped when he accidentally bumps into a cursed thing. That starts a pile of weird stuff, and he gets thrown into the world of Curses—nasty monsters born from human anger and bad vibes—after chomping down on that thing, which turns out to be a demon, the Big Boss of Curses.
Yuuji sees up close how these Curses wreck society as he finds his own new power. Pulled into the Tokyo Area Jujutsu High School, he starts walking a path he can't escape—the path of a Jujutsu magic dude.
JJK
You get a one second clip good luck
Yujis "DIE. ME. ONLY ME" scene after Sukunas domain expansion
Everyone plays this one
You all have to voice act the Naoya death sound. Closest one gets the poinst.
DOAHH
Death note
TAMOWSMMTMSWSTNBLMAMTCMOTHTHHTPEHATEHINTSTYETNIAAIWWAEMILBEETBIIATM
There are many types of monsters that scare me: Monsters who cause trouble without showing themselves, monsters who abduct children, monsters who devour dreams, monsters who suck blood... and then, monsters who tell nothing but lies. Lying monsters are a real nuisance: They are much more cunning than others. They pose as humans even though they have no understanding of the human heart; they eat even though they've never experienced hunger; they study even though they have no interest in academics; they seek friendship even though they do not know how to love. If I were to encounter such monsters, I would likely be eaten by them... because in truth, I am that monster.
I'm going to give you 5 min to text me as many animes that I've watched and the person that sends me the most correct answers gets the points.
Hooray
At that time, a colossal fox demon caused havoc everywhere. During its rampage, the village leader, performed a great feat but ended up trapping this creature inside a young boy, forever altering his life. This boy, faced bullying and hardship, yet he persisted. He told jokes and got into mischief, striving for his goal of becoming a leader to earn everyone's respect. He joined Team 7 alongside two others, under the guidance of the laid-back leader. They overcame numerous difficult challenges that strengthened their bond despite their differences. the boy constantly tried to outshine his teammates, but confronting danger and near-death moments nearly tore them apart, revealing their painful pasts.
Naruto
Yo. I'm so sorry. Guess what scene this is off of this audio I will send in the gc.
Gojo breathing heavy after 0.2 domain
Everyone plays this one
You all have to voice act the "you cryin?" line from Gojo. Closest one gets the points
Yo Weaky ten kai
Naruto
WUTRNEGAPITAWLTYRTLTMYTTTOETRAMPFSASFAEILTLYTWWHWETTLWTSWWAWTLOFATBTTBFAWATSSIOWTPIPWAWOOVAWOOOPEAWOOOLIWCSAWIATGOTUFTRI IAH
Wake up to reality Nothing ever goes as planned in this accursed world. The longer you live, the more you realize that the only things that truly exist in this reality are merely pain. suffering and futility. Listen, everywhere you look in this world, wherever there is light, there will always be shadows to be found as well. As long as there is a concept of victors, the vanquished will also exist. The selfish intent of wanting to preserve peace, initiates war. and hatred is born in order to protect love. There are nexuses causal relationships that cannot be separated.
I want to severe the fate of this world. A world of only Victors. A world of only Peace. A world of only love. I will create such a world.
I am.
The Ghost Of The Uchiha
For truly this reality...
Is a Hell
How many anime have I finished. Movies are one anime if its a stand alone one.
78
After five winters, an old fist master, now a full adult married to his lady, with a little tyke of four summers. While chillin' at a huge party on Turtle Isle with his buddies, the bash gets messed up when a space kitty not only drops secrets about his past but also snatches his child.
With the alien showing off crazy power, he's forced to team up with his old enemy to get his kid back. But when they find the orbs, the space guy says more of his relatives are coming, and they ain't gonna miss that chance.
That starts a wild story where the top guy and his pals and family are always saving the universe from even stronger villains. Weird, silly, sweet, and scary kinds all show up for a bunch of fights that push our martial arts hero and his team way beyond their limits.
Dragon ball
Watching this scene while mowing the lawn with Zooblezorp the alien. Guess it off the audio I'll send in the gc.
Todos speech after saving Yuji
Everyone plays this one
You all have to voice act the "Arise" scene from Sung Jin Woohoo. Closest one gets the points
Wakey wakey
Jujutsu Kaisen
IaiMIayIwtryIwtpIduaysBtdnIjkyAiyeraaancIkyttcyncyaIkyaaaIdnmoarfiaMtbsmtbffmascaIldBIsIjobcitwAIkkcuIraBtimritw
Yo whoever gets this right, good on you
I'll accept it, Mahito. I am you. I wanted to reject you. I wanted to pretend I didn't understand anything you said. But that's different now. I'll just kill you. And if you're ever reborn again as a new curse, I'll kill you then, too. You can change your name, change your appearance, but I'll still kill you again and again. I don't need meaning or a reason for it anymore. Maybe they'll be some meaning to be found from my actions several centuries after I'm long dead. But I'm sure I'm just... one big cog in the wheel. And I'll keep killing curses until I rust away.
Because that is my role in this war.
What made me get into Anime.
Mt dad played Dragon ball on the living room TV and I fell in love with the genre since
🚨🚨🚨 LARP QUESTION ALERT 🚨🚨🚨
Whoever picked this question, If you get this right EVERYONE will get the 500 points. If you get it wrong though there won't be a penalty on you
In the show soul eater, the character Black Star obtains a weapon with great power. What is this weapons name?
A: The Black Sword of Kunon
B: Star Splitter
C: Tsubaki
D: The Enchanted Sword
D