Fatty Acidology
This is the number of carbons present in the initial product of fatty acid synthesis.
What is 16?
This type of monotopic transmembrane protein contains an N-terminal signal peptide.
What is a Type-I transmembrane protein?
This targeting signal is present at the C-terminus of proteins that reside in the lumen of the endoplasmic reticulum.
What is KDEL?
This "jack of all trades" lipid is an important modulator of both membrane fluidity and membrane permeability in mammalian cells.
What is cholesterol?
PrPSc is partially resistant to digestion with this type of enzyme.
What is a protease?
This is the electron donor used for two of the steps in fatty acid synthesis.
What is NADPH?
Spectrin is this type of membrane protein.
What is a peripheral membrane protein?
Hydrolysis of this small molecule is used as the energy source needed to cause transfer of the ribosome/nascent peptide complex from the SRP receptor to the translocon and opening of the translocon pore.
What is GTP?
This type of sphingolipid contains a single carbohydrate molecule attached to ceramide.
What is a cerebroside?
PrPC is physically linked to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor, which contains this number of fatty acid tails.
What is 2?
This electron acceptor from the first step of fatty acid β-oxidation can generate 1.5 molecules of ATP in its reduced form.
What is FAD?
Nuclear receptors, such as the steroid hormone receptors, contain this number of transmembrane domains.
What is 0?
The following sequence, which is present within the loop between transmembrane domains #1 and #2 of a Type-IV transmembrane protein that has its N-terminus in the extracellular space, is expected to have this many N-glycans added to it:
…DRINASHGMNPTTSNNSTQVTNAGTCWNKSE…
What is 0?
This isoprene-derived molecule is the scaffold upon which N-glycans are assembled in the endoplasmic reticulum membrane.
What is dolichol phosphate?
The gene that encodes PrPC is called PRNP. This is the name of the gene that encodes PrPSc.
What is PRNP?
Essential fatty acids have double bonds starting at either of these two positions from the ω end.
What are 3 (ω-3) or 6 (ω-6)?
This special type of monotopic transmembrane protein has its TM domain located very close to its C-terminus.
What is a tail-anchored protein?
These two post-translational modifications, both of which help to anchor proteins to the inner leaflet of the plasma membrane, involve attachment of a lipid molecule via a cysteine residue.
What are S-palmitoylation and prenylation?
This type of lipid is obtained by reacting a long chain-containing alcohol with a fatty acid.
What is a wax?
This technique uses recombinant PrP and Thioflavin T to monitor the amplification of prions present in a biological sample such as cerebrospinal fluid.
What is real time quaking-induced conversion (RT-QuIC)?
When present in solution above a certain critical concentration, fatty acids self-assemble to form these structures.
What are micelles?
What is 2?
β-ketoacyl-CoA thiolase, an enzyme involved in fatty acid β-oxidation, contains this targeting signal.
What is a mitochondrial targeting sequence?
This lipid differs from traditional glycerophospholipids in that one of the fatty acid chains is attached via an ether linkage.
What is a plasmalogen?
This prion disease of deer, elk, and moose is actively spreading among wild animal populations in Alberta and Saskatchewan.
What is chronic wasting disease (CWD)?