Fatty Acidology
This fatty acid chain is solid as a pure substance at room temperature.
What is saturated fatty acids?
Glycophorin A is this type of membrane protein.
What is integral membrane protein?
Hydrolysis of this small molecule is used as the energy source needed to cause transfer of the ribosome/nascent peptide complex from the SRP receptor to the translocon and opening of the translocon pore.
This type of sphingolipid contains a single carbohydrate molecule attached to 2 galactose.
What is gangliosides?
PrPSc is resistant to partially resistant to digestion with this type of enzyme
What is proteinase K?
During fatty acid synthesis, acetyl-CoA is carboxylated to form this other key molecule.
What is Malonyl-CoA?
This type of monotopic transmembrane protein contains an internal signal sequence. Its N terminus is on the cytoplasm.
What is type 2 TM protein?
This is a protein with a sugar chain which activates as a response of inflammatory response in endothelial cells.
What is Selectin?
This is a major component of the cell wall of gram-positive bacteria, composed of a glycerol-phosphate polymer.
What is Lipoteichoic Acid (LTA)?
The T183A mutation in PRNP is known to cause genetic prion
disease. The sequence surrounding position 183
is as follows:
Normal: 180-VNITIKQH-187
Disease: 180-VNIAIKQH-187
This is an essential site that is removed by the T183A mutation.
What is N-gycosylation?
This is the hydrolysis of triacylglycerols with a base (such as sodium hydroxide) to produce glycerol and fatty acid salts (soap).
What is Saponification?
Nuclear receptors, such as the steroid hormone receptors, contain this number of transmembrane domains.
What is 0?
The following sequence, which is present within the loop between transmembrane domains #1 and #2 of a Type-IV transmembrane protein that has its N-terminus in the cytoplasm, is expected to have this many N-glycans added to it:
…DRINASHGMNPTTSNNSTQVTNAGTCWNKSE…
What is 4?
This isoprene-derived molecule is the scaffold upon which N-glycans are assembled in the endoplasmic reticulum membrane.
What is dolichol phosphate?
This type of CJD is transmitted during a medical procedure.
What is iatrogenic CJD?
This electron acceptor from the fourth step of fatty acid β-oxidation can generate 2.5 molecules of ATP in its reduced form.
What is NAD?
If 2 ATP is hydrolyzed in a Na+/K+ ATPase, this number of Na+ goes to the ER lumen while this number of K+ goes out of the ER lumen.
This post-translational modification which helps to anchor proteins to the inner leaflet of the plasma membrane, involves the attachment of a lipid molecule via a glycine residue.
What is N-myrsitoyl?
This protein specifically binds to phosphatidyl serine in the inner leaflet of the plasma membrane
What is Annexin V?
This prion disease could be transmitted from animals to humans.
Mad Cow Disease
This is the number of ATP generated when palmitic acid (16 C) is oxidized.
What is 106?
A Type-IV transmembrane protein with 7 TM domains that has its N-terminus in the lumen contains this number of internal-signal-sequences.
What is 4?
β-ketoacyl-CoA thiolase, an enzyme involved in fatty acid β-oxidation, contains this targeting signal.
What is the N terminal amphipathic alpha helix / mitochondrial?
This is the name of micro-domains in cell membranes that are enriched in certain lipids, such as cholesterol, glycolipids, and sphingolipids.
What is lipid rafts?
This technique uses recombinant PrP and Thioflavin T to monitor the amplification of prions present in a biological sample such as cerebrospinal fluid.
What is RT-QuiC?